PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr007283.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 318aa    MW: 35216.9 Da    PI: 7.9435
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr007283.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.61.6e-191562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+ +++++G g+W++ +++ g++R++k+c++rw++yl
      Pbr007283.1 15 RGPWTPEEDKRLLAYIQLHGHGSWSSLPQKAGLKRCGKSCRLRWRNYL 62
                     89*********************************************7 PP

2Myb_DNA-binding51.22.9e-1668112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++  Ed+ +++++++lG++ W++Ia++++ +Rt++++k++w+ +
      Pbr007283.1  68 RGNFSLHEDQTIIQLHALLGNR-WSAIAAHLP-KRTDNEIKNYWNAH 112
                      89********************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9181062IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-241165IPR009057Homeodomain-like
SuperFamilySSF466893.59E-3112109IPR009057Homeodomain-like
SMARTSM007174.5E-151464IPR001005SANT/Myb domain
PfamPF002495.9E-181562IPR001005SANT/Myb domain
CDDcd001675.45E-121762No hitNo description
PROSITE profilePS5129424.51463117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2566117IPR009057Homeodomain-like
SMARTSM007173.5E-1667115IPR001005SANT/Myb domain
PfamPF002499.2E-1568113IPR001005SANT/Myb domain
CDDcd001671.58E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGKSSGYAPE SGIKRGPWTP EEDKRLLAYI QLHGHGSWSS LPQKAGLKRC GKSCRLRWRN  60
YLRPDIKRGN FSLHEDQTII QLHALLGNRW SAIAAHLPKR TDNEIKNYWN AHLKKRLAKM  120
GFDPVTHKSK AAILASANGD PKKLSNLSHI AQWESARLQA EARFVKESYL RMPESAPAVS  180
LFDDYHQLAP PIVPQCLDML EASAWESLIS MSKSSSRSAA LTNDINGLDH HHVHDHGLNM  240
NGQDCGPNFQ VPISDQQLSS LMGFDEATAP SAATGSMNIN ELFGQYCGNE CSELLAVLHH  300
NIGFESEDAW TSLGKLM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-26151174105MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-261311725128MYB TRANSFORMING PROTEIN
1mse_C8e-27151174105C-Myb DNA-Binding Domain
1msf_C8e-27151174105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338977.10.0PREDICTED: transcription factor MYB57-like
TrEMBLM5WDU61e-131M5WDU6_PRUPE; Uncharacterized protein (Fragment)
STRINGPOPTR_0010s17300.13e-92(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.12e-88myb domain protein 106